Growth Factors and Cytokines Used in Cell Therapy Manufacturing

If you find any inaccurate information, please let us know by providing your feedback here

Growth Factors and Cytokines Used in Cell Therapy Manufacturing

Ước tính: 2 phút đọc, Ngày đăng:

This article is compiled based on the United States Pharmacopeia (USP) – 2025 Edition
Issued and maintained by the United States Pharmacopeial Convention (USP)

DOWNLOAD PDF HERE

1 INTRODUCTION

Qualification of reagents, source materials, and control of the manufacturing process are key elements that ensure the quality and safety of cell therapies. Growth factors and cytokines are important for the maintenance, growth, selection, and purification of cultures of cell therapy products. This chapter describes the accepted tests, procedures, and acceptance criteria for growth factors and cytokines that may be involved in the manufacturing of cell therapy products.

2 RECOMBINANT HUMAN INTERLEUKIN 4 (rhIL-4)

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNT
TEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQL
IRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTI
MREKYSKCSS   

 

C658H1071N193O197S815,096 Da

rhlL-4 is a single-chain polypeptide of 130 Amino acid residues expressed in Escherichia coli. It is produced as a lyophilized powder and contains NLT 0.5 x 107 USP Units of IL-4/mg of total protein. Process specific host-cell DNA impurities in IL-4 with limits of less than 1 ng/mg are determined as described in Nucleic Acid-Based Techniques-Approaches for Detecting Trace Nucleic Acids. (Residual DNA Testing) (1130), Neither manufacturing license nor market approval is required for IL-4 intended for use as an ancillary material during manufacturing. Following are typical IL-4 quality attributes.

3 IDENTIFICATION

A. Amino-terminal sequence analysis of at least eight amino acids is performed with an automated sequencer. Stepwise-released phenylthiohydantoin amino acids are identified with on-line reversed-phase high-performance liquid chromatography, on the basis of their elution times.

B. Use the electrophoresis method followed by western blotting analysis to visualize the IL-4 protein. The method is sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), described in the test for Purity.

Phosphate buffered saline; Laemmli sample buffer, reducing; and Laemmli sample buffer, nonreducing: Proceed as directed in the test for Purity in the Assay.

Standard stock solution: 50 µg/mL of reconstituted USP rHuman Interieukin 4 RS in Phosphate buffered saline. [NOTE-Do not agitate while mixing; swirl gently.]

Standard solution: 20 µg/mL of IL-4, from Standard stock solution, in Phosphate buffered saline

Standard solution, reducing: Combine 20 µL of Standard solution and 5 µL of Laemmli sample buffer, reducing.

Standard solution, nonreducing: Combine 20 µL of Standard solution and 5 µl of Laemmli sample buffer, nonreducing.

Sample stock solution: 50 µg/mL of reconstituted IL-4 in Phosphate buffered saline. [NOTE-Do not agitate while mixing; swirl gently.]

Sample solution: 20 µg/mL of IL-4, from Sample stock solution, in Phosphate buffered saline

Sample solution, reducing: Combine 20 µL of Sample solution and 5 µL of Laemmli sample buffer, reducing.

Sample solution, nonreducing: Combine 20 µL of Sample solution and 5 µL of Laemmli sample buffer, nonreducing.

Analysis

Samples: Standard solution, reducing; Standard solution, nonreducing; Sample solution, reducing; and Sample solution, nonreducing

Western blotting: After electrophoresis, the proteins are transferred onto a polyvinylidene fluoride (PVDF) membrane using standard procedures. Incubate the membrane for 1 h at room temperature with Phosphate buffered saline containing 0.1% Tween 20 and 5% skim milk powder. The membrane is then incubated with an anti-IL-4 antibody (diluted appropriately in Phosphate buffered saline), followed byincubation with a secondary antibody at room temperature under gentle agitation for 1 h for each of the antibodies. The IL-4 protein band is identified by developing the membrane using a suitable detection system. 2

Acceptance criteria: The developed Western blot should give a positive signal equivalent to the USP rHuman Interleukin 4 RS.

4 ASSAY

4.1 PURITY:

[NOTE-Purity is determined on the bulk material.] SDS-PAGE is performed as described under Biotechnology-Derived Articles- Polyacrylamide Gel Electrophoresis (1056), under reducing and nonreducing conditions.

Molecular weight marker: Use a suitable molecular weight marker containing protein bands between 10 and 200 kDa.

Phosphate buffered saline: 2.67 mM of potassium chloride, 1.47 mM of potassium phosphate (KH2PO4), 137.93 mM of sodium chloride, and 8.06 mM of dibasic sodium phosphate in water. Adjust to a pH of 7.0-7.3.

Laemmli sample buffer, nonreducing: 100 mM TRIS-HCI, pH 6.8, 50% Glycerol, 0.25% bromophenol blue indicator, and 10% sodium lauryl sulfate in water

Laemmli sample buffer, reducing: Add 2.5 µL mercaptoethanol to 50 µL of Laemmli sample buffer, nonreducing.

Sample stock solution: 400 µg/mL of bulk IL-4 in Phosphate buffered saline

Sample solution 1: Combine 20 µL of Sample stock solution and 5 µL of Laemmli sample buffer, nonreducing.

Sample solution 2: Combine 20 µL of Sample stock solution and 5 µl of Laemmli sample buffer, reducing.

Control A stock solution: 4 µg/mL of IL-4, from Sample stock solution, in Phosphate buffered saline. [NOTE-Control A solutions are run in triplicates in both reducing and nonreducing conditions.]

Control A solution 1: Combine 20 µL of Control A stock solution and 5 µL of Laemmli sample buffer, nonreducing.

Control A solution 2: Combine 20 µL of Control A stock solution and 5 µL of Laemmli sample buffer, reducing.

Control B stock solution: 12 µg/mL of IL-4, from Sample stock solution, in Phosphate buffered saline. [NOTE-Control B solutions are run in duplicates in both reducing and nonreducing conditions.]

Control B solution 1: Combine 20 µL of Control B stock solution and 5 µL of Laemmli sample buffer, nonreducing.

Control B solution 2: Combine 20 µL of Control B stock solution and 5 µL of Laemmli sample buffer, reducing.

Electrophoretic conditions

(See Biotechnology-Derived Articles-Polyacrylamide Gel Electrophoresis (1056).)

Mode: Discontinuous PAGE gel

Stacking gel: 4% acrylamide

Resolving gel: 12% acrylamide

Run conditions: 10 min at 100 V; then 30 min at 200 V

Protein detection: Silver stain

4.1.1 Analysis

Samples: Sample solution 1, Sample solution 2, Control A solution 1, Control A solution 2, Control B solution 7, and Control B solution 2 Incubate 25 µL of each Sample solution and Control solution under nonreducing conditions for 5 min at 60°, and load onto the gel. Incubate 20 µl of each Sample solution and Control solution under reducing conditions for 5 min at 60", and load onto the gel. After silver staining and scanning the whole gel, determine the intensity of all detectable protein bands by densitometry, and calculate the percentage of each detectable protein band, in the Sample solution, twice by comparing the pixel intensity of each contaminating band with the mean value of Control solutions A and B, respectively, by the formulas:

Result = (A100) x 1/(A1) and

Result = (A100)×3/(A3)

A100 = intensity of one contaminating band of the Sample solution

A1 = mean intensity of all detectable bands of Control A solution

A3 = mean intensity of all detectable bands of Control B solution

IL-4 control solutions analysis should yield one detectable band with an apparent molecular weight of approximately 15 kDa. If values calculated by means of Control A solution are different from those revealed by comparison with Control B solution, the value corresponding to the highest amount of impurity should be taken. If the intensity of one of the contaminating bands is lower than the value of Control A solution (corresponding to 1%), the value of this contamination is set to 1%. The purity of the sample solution is then calculated:

Result = 100 - ΣCn

C = percentage of each contamination given in rounded whole numbers

n = number of contaminants of the IL-4 Sample solution

Acceptance criteria: The purity of IL-4 is NLT 97%, as determined by SDS-PAGE

4.2 PROTEIN CONTENT:

[NOTE-Protein content is determined on the basis of the packaged product.]

Phosphate buffered saline: Proceed as directed in the test for Purity.

Sample solution: 50 µg/mL of IL-4 in Phosphate buffered saline. [NOTE-Do not agitate while mixing, swirl gently.]

Blank: Phosphate buffered saline

Spectrometric conditions

(See Ultraviolet-Visible Spectroscopy (857).)

Mode: UV

Pathlength: 1 cm

Analytical wavelength: 280 nm

4.2.1 Analysis

Samples: Sample solution and Blank Calculate the protein concentration:

C = A280/0.63

C = IL-4 concentration of the Sample solution (mg/mL)

A280 = absorbance at 280 nm

5 SPECIFIC TESTS

5.1 BIOIDENTITY:

[NOTE-The biological activity measurement is determined on the basis of the packaged product.]
RPMI 1640 medium with L-glutamine: Prepare a mixture of the ingredients in the quantities shown in sufficient water to obtain 1 L of medium, and sterilize by filtration:

MaterialQuantity
Calcium nitrate (Ca(NO3) . 4H2O)100 mg
Magnesium sulfate (MgSO4 . 7H2O)100 mg
Potassium chloride400 mg
Sodium chloride6000 mg
Sodium phosphate, dibasic anhydrous800 mg
Sodium bicarbonate2000 mg
Glycine10 mg
L-arginine200 mg
L-Asparagine50 mg
L-Aspartic acid20 mg
L-Polyvinylidene fluoride-cystine dihydrochloride20 mg
L-Glutamic acid20 mg
L-Glutamine300 mg
1-Histidine15 mg
1-Hydroxyproline20 mg
L-Isoleucine50 mg
L-Leucine50 mg
L-Lysine hydrochloride40 mg
L-Methionine15 mg
L-Phenylalanine15 mg
L-Proline20 mg
L-Serine30 mg
L-Threonine20 mg
L-Tryptophan5 mg
L-Tyrosine disodium salt dihydrate20 mg
L-Valine20 mg
Biotin0.2 mg
Choline chloride3 mg 
D-Calcium pantothenate0.25 mg
Folic acid1 mg
i-Inositol35 mg
Niacinamide1 mg
para-Aminobenzoic acid1 mg
Pyridoxine hydrochloride1 mg
Riboflavin0.2 mg
Thiamine hydrochloride1 mg
Vitamin B120.005 mg
D-Glucose (dextrose)2000 mg
Glutathione (reduced)1 mg
Phenol red5 mg

Growth medium: Using aseptic procedures, prepare the following tissue culture medium:

RPMI-1640 with L-glutamine 500 mL
Sodium pyruvate 100 mM5 mL
Glutathione (reduced)50 mL
Human r GM-CSFa3 x 104 International Units

aGranulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) is added extemporaneously.

Sterilize by filtration, and store at between 2° to 8°. Use within 1 month. Add GM-CSF immediately before use.

Assay medium: Use Growth medium containing no GM-CSF.

Phosphate buffered saline: Proceed as directed in the test for Purity in the Assay.

Resazurin solution: 11 mg of resazurin in 100 mL of Phosphate buffered saline. [Note—Sterile filter and store solution protected from light at 4°. Resazurin solution is stable for at least 6 months if treated under sterile conditions.]

[Not-For all Standard and Sample solutions, IL-4 concentration is determined by photometry at 280 nm using an extinction coefficient (ε) of 0.63 mg−1cm−1.]

Standard stock solution: 50 μg/mL of USP rHuman Interleukin 4 RS in Phosphate buffered saline. [Note—Do not agitate while mixing; swirl gently.]

Standard solutions: 36, 12, 4, 1.33, 0.44, 0.15, 0.05, 0.016, 0.006 ng/mL of IL-4, from Standard stock solution in Assay medium

Sample stock solution: 50 µg/mL of IL-4 in Phosphate buffered saline. [NOTE-Do not agitate while mixing; swirl gently.]

Sample solutions: 36, 12, 4, 1.33, 0.44, 0.15, 0.05, 0.016, 0.006 ng/mL of IL-4, from Sample stock solution in Assay medium

Control solution: Use the Assay medium.

Cell culture preparation: Prepare cell cultures of the human factor-dependent TF-1 cell line (ATCC No. CRL-2003), following the protocol described in the ATCC information sheet. Passage the cultures every 2-3 days, using 1:3 subcultures of the cells for up to 1 month. Seed density should be 0.5 x 106 cells/mL, and maximal density should be 3 x 105 cells/mL. Viability of the cells should be >90%. Maximal passage number is 24, and maximal cultivation time from thawing is 28 days. After 28 days, initiate a new culture. Cells are propagated using Growth medium at 37°, supplemented with air and 5% carbon dioxide.

5.1.1 Analysis

Samples: Standard solutions, Sample solutions, and Control solution

The activity of the Sample solution is determined in duplicate. Wash the cells three times in Phosphate buffered saline. Plate 2 x 104 TF-1 cells resuspended in 100 µL of Assay medium per well in 96-well, flat-bottom microplates. Incubate for 72 h at 37° and 5% CO2 atmosphere in a humidified incubator in the presence or absence of various concentrations of Standard solution, Sample solution, or Control solution by adding 100 µl of the corresponding solution to each well. Add 30 µL of Resazurin solution to each well and incubate for another 24 h. Determine the fluorescence intensity per well by reading the plate with a microplate reader using 544 nm (excitation) and 590 nm (emission). Convert the fluorescence intensity in each well to a percentage of the maximum fluorescence intensity. For the Sample solution and Standard solution, plot the percentage of fluorescence intensity versus the concentration of the respective solution. By using the least squares method of regression analysis, compute the ED50 in ng/mL of the Sample solution and the Standard solution. The coefficient of determination for curve regression should be ≥ 0.98. Calculate the potency in USP Interleukin 4 Units/mg:

Result = A x ES/EU

A = activity of USP rHuman Interleukin 4 RS (USP units/mg)

ES = determined ED50 of Standard solution (ng/mL)

EU = determined ED50 of Sample solution (ng/mL)

Acceptance criteria: NLT 0.5 × 107 USP IL-4 Units/mg

STERILITY TESTS (71): Meets the requirements

BACTERIAL ENDOTOXINS TEST (85): It contains NMT 50 USP Endotoxin Units/mg.

6 ADDITIONAL REQUIREMENTS

PACKAGING AND STORAGE: Preserve in tight containers, and store at -80°.

LABELING: Material is of recombinant DNA origin.

USP REFERENCE STANDARDS (11)

USP Endotoxin RS

USP rHuman Interleukin 4 RS

vui lòng chờ tin đang tải lên

Vui lòng đợi xử lý......

0 SẢN PHẨM
ĐANG MUA
hotline
0927.42.6789